Invivogen
Menu

Recombinant human STING [ NEW ]

Recombinant human STING Unit size Cat. code Docs Qty Price
CHO expressed human STING (R232) protein
25 µg
rec-hsting
+-
$391.00
backorder

NEW PRODUCT

STING (stimulator of interferon genes; also known as TMEM173, MITA, MPYS, and ERIS) is essential for the interferon response to microbial or self-DNA, and acts as a direct sensor of cyclic dinucleotides (CDNs). CDNs are important messengers in bacteria, affecting numerous responses of the prokaryotic cell, but also in mammalian cells, acting as agonists of the innate immune response.

STING senses the presence of CDNs in the cytoplasm through its soluble CDN-binding domain [1]. Several non‑synonymous variants of STING have been described in the human population. The prevalent human STING isoform (~60% of the human population) contains an arginine at position 232 (R232) and is thus considered as wild‑type [2,3]. Recombinant human STING corresponds to the cytoplasmic domain of the R232 variant. This protein is produced in Chinese hamster ovary (CHO) cells transfected with a DNA sequence encoding a polypeptide chain containing the soluble CDN-binding domain. Recombinant human STING was purified by affinity chromatography.

 

1. Yin Q. et al., 2015. Structural biology of innate immunity. Annu Rev Immunol. 33:393-416.
2. Jin L. et al., 2011. Identification and characterization of a loss-offunction human MPYS variant. Genes Immun. 12(4):263-9.
3. Yi G. et al., 2013. Single nucleotide polymorphisms of human STING can affect Innate immune response to cyclic dinucleotides. PLoS One 8(10):e77846.

Back to the top

Specifications

Source: Mammalian; CHO cells

Predicted molecular mass: 27.3 kDa

Molecular mass: ~27 kDa (SDS-PAGE)

Amino acids: 137-379

Gene Name: TMEM173

Gene ID: 340061

UniProt ID: Q86WV6

Variant: R232

Formulation: Recombinant human STING was lyophilized from a 0.2 μm filtered phosphate buffer solution (pH 7.4) with 5% (w/v) saccharose

Quality control:

  • Purity greater than 90% as determined by SDS-PAGE
  • The absence of bacterial contamination (e.g. lipoproteins and endotoxins) has been confirmed using HEK-Blue™ TLR2 and HEK‑Blue™ TLR4 cells.

Applications

  • Analyzing protein-ligand interactions
  • ELISA
  • Western blotting
Back to the top

Contents

  • 25 μg of recombinant human STING (R232 variant)
  • 1.5 ml sterile endotoxin-free water

room temperature Recombinant human STING is shipped at room temperature.

store Upon receipt it should be stored at -20°C. - Upon resuspension, prepare aliquots of recombinant human STING and store at -20°C.

stability Resuspended product is stable for 6 months when properly stored.

Alert Avoid repeated freeze-thaw cycles.

Back to the top

Details

Sequence: 
KGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQ
ARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMAD
PNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGT
CVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLE
DILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQE
EKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS

Purification gel

Back to the top

Customer Service
& Technical Support

CAPTCHA
In order to prevent automated spam submissions, please answer the following question:
10 + 5 =
Solve this simple math problem and enter the result. E.g. for 1+3, enter 4.
Shopping cart is empty